English to Latvian Meaning :: skill

Skill :
prasme
prasme, meistarība, māka, iemaņa, veiklība, izveicība - prasmedeskilldeskillednekvalificēts cilvēksdeskillsprasmeprasmīgsiemaņas
 
Facebook Twitter Linkedin Gmail Share More

Show English Meaning
(+)

Noun(1) An ability that has been acquired by training(2) Ability to produce solutions in some problem domain(3) Ability(4) Talent to do something

Show Examples
(+)

(1) Difficult work, taking great skill(2) British hangmen, we were told, took pride in their skill and efficiency.(3) The next most important thing that comes though is to pass on one's skill and experience.(4) He will apply them with the benefit of his professional skill and experience.(5) He is a player of real talent and skill and has the ability to make a real and lasting impression at the highest level.(6) Because of that, all of these transferable skill sets actually don't get to play out in the workplace.(7) Young girls may boast good health but they lack experience, skill and tolerance.(8) He has little skill as a writer(9) They are asking for a fair day's pay for a fair day's work that reflects their expertise and skill .(10) She covers this with deft skill and a versatile voice that can sweetly caress or swoop with camp theatrical grandeur.(11) I marvel at the almost boundless ingenuity and skill of mankind sometimes.(12) After a comprehension check, follow with some literacy skill development.(13) He has everything: height, strength, skill and the ability to hold the ball under pressure.(14) Her skill at drawing(15) The greatest disparity in performance between the two tests occurred in students with high literacy skill levels in both languages.(16) As if he hadn't heard her, he continued to steer the car, maneuvering it with expert skill .
Related Words
(1) soft skill ::
mīksts prasme
(2) communication skill ::
komunikācijas prasme
(3) skill set ::
prasmju komplekts
(4) skill point ::
prasme punkts
(5) technical skill ::
tehniskā prasme
(6) special skill ::
īpaša prasme
(7) language skill ::
valodas prasme
(8) life skill ::
prasme
(9) hard skill ::
grūti prasme
(10) writing skill ::
rakstīšanas prasme
Synonyms
Noun
1. expertise ::
ekspertīze
2. ability ::
spēja
3. science ::
zinātne
4. accomplishment ::
sasniegums
Antonyms
1. Ignorance
  
2. Inability
  
3. Incapability
  
4. Incapacity
  
5. Inexperience
  
Different Forms
deskill, deskilled, deskilling, deskills, skill, skilled, skills
Word Example from TV Shows

The best way to learn proper English is to read news report, and watch news on TV. Watching TV shows is a great way to learn casual English, slang words, understand culture reference and humor. If you have already watched these shows then you may recall the words used in the following dialogs.

limited skill set...

limited SKILL set...

Westworld Season 2, Episode 7


No one had such skill
with a spear.

No one had such SKILL with a spear.

Game of Thrones Season 7, Episode 3


And I need to update my resume
to include swimming as a special skill.

And I need to update my resume to include swimming as a special SKILL.

The Big Bang Theory Season 10, Episode 24


It\'s not a gift. It\'s a skill.
Anyone can learn it.

It's not a gift. It's a SKILL. Anyone can learn it.

Game of Thrones Season 5, Episode 9


Pictionary is not a true test
of any real intelligence or skill.

Pictionary is not a true test of any real intelligence or SKILL.

The Big Bang Theory Season 6, Episode 4


English to Latvian Dictionary: skill

Meaning and definitions of skill, translation in Latvian language for skill with similar and opposite words. Also find spoken pronunciation of skill in Latvian and in English language.

Tags for the entry 'skill'

What skill means in Latvian, skill meaning in Latvian, skill definition, examples and pronunciation of skill in Latvian language.

Latvian.English-Dictionary.Help | English to Latvian Dictionary

This is not just an ordinary English to Latvian dictionary & Latvian to English dictionary. This dictionary has the largest database for word meaning. It does not only give you English toLatvian and Latvian to English word meaning, it provides English to English word meaning along with Antonyms, Synonyms, Examples, Related words and Examples from your favorite TV Shows. This dictionary helps you to search quickly for Latvian to English translation, English to Latvian translation. It has more than 500,000 word meaning and is still growing. This English to Latvian dictionary also provides you an Android application for your offline use. The dictionary has mainly three features : translate English words to Latvian translate Latvian words to English, copy & paste any paragraph in the Read Text box then tap on any word to get instant word meaning. This website also provides you English Grammar, TOEFL and most common words.
Learn Prepositions by Photos
Commonly confused words
form of verbs
Learn 300+ TOEFL words
Fill in the blanks
Topic Wise Words
Learn 3000+ common words
Words Everyday
Most Searched Words
GRE words
Android App
iPhone App
Chrome Extension

Blog List

Topic Wise Words

Learn 3000+ Common Words

Learn Common GRE Words

Learn Words Everyday

Your Favorite Words
Currently you do not have any favorite word. To make a word favorite you have to click on the heart button.
Your Search History
All Dictionary Links